PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28443.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 532aa    MW: 60496.1 Da    PI: 7.8033
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28443.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.45.2e-11233266135
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgR 35 
                              +g WT++Ed ll+++v++ G++ W++Ia++++ gR
  mrna28443.1-v1.0-hybrid 233 KGQWTEDEDRLLAQLVQKNGMKKWSLIAAKLN-GR 266
                              799*****************************.98 PP

2Myb_DNA-binding569.1e-18269309345
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                               W++eEd++l++a+ +lG++ W+ Ia++++ gRt++ +k++w+
  mrna28443.1-v1.0-hybrid 269 MWSEEEDKILIEAHMELGNR-WAEIAKRLP-GRTENTIKNHWN 309
                              6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.899228260IPR017877Myb-like domain
SuperFamilySSF466892.82E-20231308IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-11231267IPR009057Homeodomain-like
SMARTSM007173.5232264IPR001005SANT/Myb domain
PfamPF002497.0E-10233266IPR001005SANT/Myb domain
PROSITE profilePS5129420.663262316IPR017930Myb domain
SMARTSM007172.2E-15266314IPR001005SANT/Myb domain
PfamPF002491.3E-16268309IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-19270310IPR009057Homeodomain-like
CDDcd001671.51E-13270312No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 532 aa     Download sequence    Send to blast
MEFRDESGFP LLSSYFSGAK QQAPPESLNQ NSRFYRPPSS PHGNYKPNTL YNNHFHFQNQ  60
DRGIDLNYSD QYHHTSPLLG GTTIEGSSSN PFGGVDLPTI EGFSPFDACY NHPNDVNVFP  120
YASAAAVSFS DSQKAVMHGG WEDYDDEDLR HRHPHNHHHQ MSSVAQEGSC VQLPPLINYQ  180
DIESAAPRVM RPAVDEYSCN MAYMEHDQLS KKKRYYVNKA SKQQEDDEGT LIKGQWTEDE  240
DRLLAQLVQK NGMKKWSLIA AKLNGRKEMW SEEEDKILIE AHMELGNRWA EIAKRLPGRT  300
ENTIKNHWNA TKRKRYIKRK PSTKINLNVK GNSTSTVNES ILLSKYIKSV ERSEERKNGK  360
VAAMDYGEPS SPADSKVYRR RFERKKEKST AVYDIPDYEV YPSKSNKSVV KSSAKARNKG  420
KVTEEVYEQS RGLFDLPDSE VYRPQFESSP NAWLASLRAA AAARKKQQDD SSVEATMGSS  480
SSYLSSMYSE FNGYGNDTRL SLEMNGYMQE QAQSKRPDVD LVEMINNAKR H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C1e-262313152104C-Myb DNA-Binding Domain
1mse_C1e-262313152104C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306352.10.0PREDICTED: transcription factor MYB98-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2616822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-37myb domain protein 98